Frmd6 Peptide - C-terminal region
Frmd6 Peptide - C-terminal region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Frmd6 Rabbit Polyclonal Antibody (orb581873) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
F1LR29
Preservative
Lyophilized powder
AA Sequence
PQTICRKPKTSTDRHSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RG238924 10 µg
FAM190B (CCSER2) (NM_001284241) Human Tagged ORF Clone
Sign In for Pricing
View Details 