Frmd6 Peptide - C-terminal region
Frmd6 Peptide - C-terminal region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Frmd6 Rabbit Polyclonal Antibody (orb581873) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
F1LR29
Preservative
Lyophilized powder
AA Sequence
PQTICRKPKTSTDRHSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-E945390-25MG 25 mg
(aS,4R)-a-Ethyl-2-oxo-4-propyl-1-pyrrolidineacetic Acid (~85:15 d.r.)
Sign In for Pricing
View Details 
