RGD1561459 Peptide - N-terminal region
RGD1561459 Peptide - N-terminal region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RGD1561459 Rabbit Polyclonal Antibody (orb325983) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
D3ZZQ4
Preservative
Lyophilized powder
AA Sequence
IASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881081-500 1x 500 µL
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940956-100 1x 100 µL
UACA / Nucling (AE-5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471687-500 1x 500 µL
VEGF (Vascular Endothelial Growth Factor) (VG76e), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details