Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEPACAM Peptide - N-terminal region

HEPACAM Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1306811

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HEPACAM Rabbit Polyclonal Antibody (orb326000) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_002727080

Preservative

Lyophilized powder

AA Sequence

ALRLSPFVYLLLIQPVPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PUM2 (Pumilio Homolog 2 (Drosophila), FLJ36528, KIAA0235, MGC138251, MGC138253, PUMH2, PUML2) (MaxLight 405)
MBS6197500-01 0.1 mL

PUM2 (Pumilio Homolog 2 (Drosophila), FLJ36528, KIAA0235, MGC138251, MGC138253, PUMH2, PUML2) (MaxLight 405)

Sign In for Pricing
View Details
PUM2 (Pumilio Homolog 2 (Drosophila), FLJ36528, KIAA0235, MGC138251, MGC138253, PUMH2, PUML2) (MaxLight 405)
MBS6197500-02 5x 0.1 mL

PUM2 (Pumilio Homolog 2 (Drosophila), FLJ36528, KIAA0235, MGC138251, MGC138253, PUMH2, PUML2) (MaxLight 405)

Sign In for Pricing
View Details
Rabbit Anti BAG1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC,Immunofluorescence)
IRBAMLBAG1AP187200UL 1 Each

Rabbit Anti BAG1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC,Immunofluorescence)

Sign In for Pricing
View Details
Recombinant Human Angiopoietin-2 CF
623-AN-025/CF 25 µg

Recombinant Human Angiopoietin-2 CF

Sign In for Pricing
View Details
Lysosomal Associated Membrane Protein 1 (LAMP1) Monoclonal Antibody
CAU32504-01 100 µL

Lysosomal Associated Membrane Protein 1 (LAMP1) Monoclonal Antibody

Sign In for Pricing
View Details
Lysosomal Associated Membrane Protein 1 (LAMP1) Monoclonal Antibody
CAU32504-02 200 µL

Lysosomal Associated Membrane Protein 1 (LAMP1) Monoclonal Antibody

Sign In for Pricing
View Details