Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEPACAM Peptide - N-terminal region

HEPACAM Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1306811

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HEPACAM Rabbit Polyclonal Antibody (orb326000) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_002727080

Preservative

Lyophilized powder

AA Sequence

ALRLSPFVYLLLIQPVPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PathScan® RP Total IRF-7 Sandwich ELISA Kit
CST 45011V3 20 Kit

PathScan® RP Total IRF-7 Sandwich ELISA Kit

Sign In for Pricing
View Details
SNRPB Human Over-expression Lysate
orb1355084 100 µg

SNRPB Human Over-expression Lysate

Sign In for Pricing
View Details
CLDND2 (NM_152353) Human Tagged Lenti ORF Clone
RC206308L4 10 µg

CLDND2 (NM_152353) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Enterobacter sp. 1-deoxy-D-xylulose-5-phosphate synthase (dxs), partial
MBS1261322 Inquire

Recombinant Enterobacter sp. 1-deoxy-D-xylulose-5-phosphate synthase (dxs), partial

Sign In for Pricing
View Details
Anti-SLC22A4 Antibody Picoband®
A03032-1-carrier-free 100 µg/Vial

Anti-SLC22A4 Antibody Picoband®

Sign In for Pricing
View Details
EL28Z Antibody
PHY7899A Inquire

EL28Z Antibody

Sign In for Pricing
View Details