Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mapk11 Peptide - N-terminal region

Mapk11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P38beta

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mapk11 Rabbit Polyclonal Antibody (orb583159) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

D4A3U7

Preservative

Lyophilized powder

AA Sequence

VPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GPR52 Knockout A549 cell line
GTR15416098 1 Vial

Human GPR52 Knockout A549 cell line

Sign In for Pricing
View Details
Recombinant Human SLC27A3
P9167-01 50 µg

Recombinant Human SLC27A3

Sign In for Pricing
View Details
Recombinant Human SLC27A3
P9167-02 200 µg

Recombinant Human SLC27A3

Sign In for Pricing
View Details
Recombinant Human SLC27A3
P9167-03 1 mg

Recombinant Human SLC27A3

Sign In for Pricing
View Details
Bovine Cytoplasmic polyadenylation element binding protein 4 (CPEB4) ELISA Kit
GTR10334100 96 Well

Bovine Cytoplasmic polyadenylation element binding protein 4 (CPEB4) ELISA Kit

Sign In for Pricing
View Details
Anti-TRIM14 Rabbit pAb
GB115627-50 50 μL

Anti-TRIM14 Rabbit pAb

Sign In for Pricing
View Details