Ubl3 Peptide - N-terminal region
Ubl3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AW108023, HCG
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ubl3 Rabbit Polyclonal Antibody (orb330888) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
Q9Z2M6
Preservative
Lyophilized powder
AA Sequence
VPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401784-500 1x 500 µL
Histone H1 (Nuclear Marker) (HH1/1784R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-CL-H0898-01 24 Tests
Human RNASE3/ECP (Ribonuclease A3/Eosinophil Cationic Protein) CLIA Kit
Sign In for Pricing
View Details E-CL-H0898-02 48 Tests
Human RNASE3/ECP (Ribonuclease A3/Eosinophil Cationic Protein) CLIA Kit
Sign In for Pricing
View Details E-CL-H0898-03 96 Tests
Human RNASE3/ECP (Ribonuclease A3/Eosinophil Cationic Protein) CLIA Kit
Sign In for Pricing
View Details 
