Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbc1d7 Peptide - C-terminal region

Tbc1d7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610009C09Rik

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tbc1d7 Rabbit Polyclonal Antibody (orb326140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q9D0K0

Preservative

Lyophilized powder

AA Sequence

ISRCFVKQLNNKYRDALPQLPKAFEQYLNLEDSRLLSHLKTCSAVSKLPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSPG4 polyclonal antibody
BS70553-01 50 µL

CSPG4 polyclonal antibody

Sign In for Pricing
View Details
CSPG4 polyclonal antibody
BS70553-02 100 µL

CSPG4 polyclonal antibody

Sign In for Pricing
View Details
Klf14 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3627803 1.0 µg DNA

Klf14 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
FKBP1B Antibody
orb1259030 100 µL

FKBP1B Antibody

Sign In for Pricing
View Details
MEK7/MAP2K7 Rabbit Polyclonal Antibody (Biotin)
orb2576348 100 µg

MEK7/MAP2K7 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
SPARCL1 Antibody - N-terminal region : FITC (ARP48263_P050-FITC)
ARP48263_P050-FITC 100 µL

SPARCL1 Antibody - N-terminal region : FITC (ARP48263_P050-FITC)

Sign In for Pricing
View Details