Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zcchc8 Peptide - C-terminal region

Zcchc8 Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zcchc8 Rabbit Polyclonal Antibody (orb583400) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

FQPPLPPGTPPPLPQGTPPPLFTPPLPKGTPPLTPSDSPQPRPTASGVDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Lipase Member K Antibody
NBP3-09522-100ul 100 µL

Rabbit Polyclonal Lipase Member K Antibody

Sign In for Pricing
View Details
Recombinant Human TM4SF5 Protein, N-GST & C-His
orb2962944-01 50 µg

Recombinant Human TM4SF5 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human TM4SF5 Protein, N-GST & C-His
orb2962944-02 100 µg

Recombinant Human TM4SF5 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human TM4SF5 Protein, N-GST & C-His
orb2962944-03 1 mg

Recombinant Human TM4SF5 Protein, N-GST & C-His

Sign In for Pricing
View Details
AARE Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-5983R-BF555 100 µL

AARE Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
PIC 327-N-A5-B7527 AC Signs
808493 Card of 1 Pictogram(s)

PIC 327-N-A5-B7527 AC Signs

Sign In for Pricing
View Details