Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zcchc8 Peptide - C-terminal region

Zcchc8 Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zcchc8 Rabbit Polyclonal Antibody (orb583400) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

FQPPLPPGTPPPLPQGTPPPLFTPPLPKGTPPLTPSDSPQPRPTASGVDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HIST1H3A [p Ser10] Antibody (rPHH3/6824) [CoraFluor 1]
NBP3-14043CL1 0.1 mL

Mouse Monoclonal HIST1H3A [p Ser10] Antibody (rPHH3/6824) [CoraFluor 1]

Sign In for Pricing
View Details
PLD6 rabbit pAb
MBS8600777-01 0.1 mL

PLD6 rabbit pAb

Sign In for Pricing
View Details
PLD6 rabbit pAb
MBS8600777-02 0.1 mL (AF405L)

PLD6 rabbit pAb

Sign In for Pricing
View Details
PLD6 rabbit pAb
MBS8600777-03 0.1 mL (AF405S)

PLD6 rabbit pAb

Sign In for Pricing
View Details
PLD6 rabbit pAb
MBS8600777-04 0.1 mL (AF610)

PLD6 rabbit pAb

Sign In for Pricing
View Details
PLD6 rabbit pAb
MBS8600777-05 0.1 mL (AF635)

PLD6 rabbit pAb

Sign In for Pricing
View Details