Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gpatc2 Peptide - C-terminal region

Gpatc2 Peptide - C-terminal region

Product Specifications

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gpatc2 Rabbit Polyclonal Antibody (orb326147) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q6AY15

Preservative

Lyophilized powder

AA Sequence

DELRSESDSSSLSSTDAGLFTNDEGRQVFILIVRNFKVRSPSKGKLMSGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-6919-3p miRNA Inhibitor
orb1869614-01 10 nmol

Mmu-miR-6919-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-6919-3p miRNA Inhibitor
orb1869614-02 20 nmol

Mmu-miR-6919-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mouse RNMT shRNA Plasmid
abx976387-01 150 µg

Mouse RNMT shRNA Plasmid

Sign In for Pricing
View Details
Mouse RNMT shRNA Plasmid
abx976387-02 300 µg

Mouse RNMT shRNA Plasmid

Sign In for Pricing
View Details
Goat β2 Glycoprotein ELISA kit
GTR10391140 96 Well

Goat β2 Glycoprotein ELISA kit

Sign In for Pricing
View Details
P53, phosphorylated (S33)
329076-01 50 µg

P53, phosphorylated (S33)

Sign In for Pricing
View Details