Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gpatc2 Peptide - C-terminal region

Gpatc2 Peptide - C-terminal region

Product Specifications

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gpatc2 Rabbit Polyclonal Antibody (orb326147) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q6AY15

Preservative

Lyophilized powder

AA Sequence

DELRSESDSSSLSSTDAGLFTNDEGRQVFILIVRNFKVRSPSKGKLMSGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIPL1 Antibody - middle region
MBS3220603-01 0.1 mL

AIPL1 Antibody - middle region

Sign In for Pricing
View Details
AIPL1 Antibody - middle region
MBS3220603-02 5x 0.1 mL

AIPL1 Antibody - middle region

Sign In for Pricing
View Details
Human Procollagen II C-terminal peptide (PIICP) ELISA Kit
YLA0399HU-01 48 Tests

Human Procollagen II C-terminal peptide (PIICP) ELISA Kit

Sign In for Pricing
View Details
Human Procollagen II C-terminal peptide (PIICP) ELISA Kit
YLA0399HU-02 96 Tests

Human Procollagen II C-terminal peptide (PIICP) ELISA Kit

Sign In for Pricing
View Details
Rat Integrin β1 ELISA kit
GTR10372130 96 Well

Rat Integrin β1 ELISA kit

Sign In for Pricing
View Details
Recombinant Human TGF-beta 1 ACFP Protein
ACFP240-010 10 µg

Recombinant Human TGF-beta 1 ACFP Protein

Sign In for Pricing
View Details