Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eapp Peptide - N-terminal region

Eapp Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1309624

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eapp Rabbit Polyclonal Antibody (orb583495) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

B5DF09

Preservative

Lyophilized powder

AA Sequence

PALSSSEDEVDVLLHGTPDQKRKLIRECLTGESESSEDEFEKEMEAELNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rfx1 ORF Vector (Rat) (pORF)
38879016 1.0 µg DNA

Rfx1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Chicken Non-Neuronal Enolase ELISA Kit
MBS045655 Inquire

Chicken Non-Neuronal Enolase ELISA Kit

Sign In for Pricing
View Details
Octaneuropeptide
orb321137 1 mg

Octaneuropeptide

Sign In for Pricing
View Details
Rabbit Polyclonal ZBTB8A Antibody [CoraFluor 1]
NBP1-76521CL1 0.1 mL

Rabbit Polyclonal ZBTB8A Antibody [CoraFluor 1]

Sign In for Pricing
View Details
4,6-Dimethoxy-2'-methyl-3,4',6'-grisantrione
010527 10 mg

4,6-Dimethoxy-2'-methyl-3,4',6'-grisantrione

Sign In for Pricing
View Details
PNK1 (Phospho-Ser114/Thr118) Rabbit Polyclonal Antibody
BT-AP12042-01 20 µL

PNK1 (Phospho-Ser114/Thr118) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details