Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eapp Peptide - N-terminal region

Eapp Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1309624

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eapp Rabbit Polyclonal Antibody (orb583495) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

B5DF09

Preservative

Lyophilized powder

AA Sequence

PALSSSEDEVDVLLHGTPDQKRKLIRECLTGESESSEDEFEKEMEAELNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibrillarin (FBL) Antibody
abx141589-01 50 µL

Fibrillarin (FBL) Antibody

Sign In for Pricing
View Details
Fibrillarin (FBL) Antibody
abx141589-02 100 µL

Fibrillarin (FBL) Antibody

Sign In for Pricing
View Details
Fibrillarin (FBL) Antibody
abx141589-03 200 µL

Fibrillarin (FBL) Antibody

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) hsd17b12b Polyclonal Antibody
MBS7199283 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) hsd17b12b Polyclonal Antibody

Sign In for Pricing
View Details
Listeriolysin Rabbit pAb, PE-Cy5 conjugated
orb2881358 100 µL

Listeriolysin Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
6-Bromo-8-methoxy-1,2,3,4-tetrahydroquinoline
NFC05645-01 50 mg

6-Bromo-8-methoxy-1,2,3,4-tetrahydroquinoline

Sign In for Pricing
View Details