Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnaja4 Peptide - C-terminal region

Dnaja4 Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnaja4 Rabbit Polyclonal Antibody (orb583504) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q4QR73

Preservative

Lyophilized powder

AA Sequence

IIEVHVDKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTI-55 Hydrochloride
TRC-R701010-10MG 10 mg

RTI-55 Hydrochloride

Sign In for Pricing
View Details
TNFRSF8 Polyclonal Antibody
E-AB-16310-01 20 µL

TNFRSF8 Polyclonal Antibody

Sign In for Pricing
View Details
TNFRSF8 Polyclonal Antibody
E-AB-16310-02 60 µL

TNFRSF8 Polyclonal Antibody

Sign In for Pricing
View Details
TNFRSF8 Polyclonal Antibody
E-AB-16310-03 120 µL

TNFRSF8 Polyclonal Antibody

Sign In for Pricing
View Details
TNFRSF8 Polyclonal Antibody
E-AB-16310-04 200 µL

TNFRSF8 Polyclonal Antibody

Sign In for Pricing
View Details
P-Desthioxo, P-Oxo Bensulide
TRC-B365945-50MG 50 mg

P-Desthioxo, P-Oxo Bensulide

Sign In for Pricing
View Details