Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnaja4 Peptide - C-terminal region

Dnaja4 Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnaja4 Rabbit Polyclonal Antibody (orb583504) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q4QR73

Preservative

Lyophilized powder

AA Sequence

IIEVHVDKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CCL3/MIP-1α Protein (Trx Tag)
PDEM100167-01 20 µg

Recombinant Mouse CCL3/MIP-1α Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse CCL3/MIP-1α Protein (Trx Tag)
PDEM100167-02 100 µg

Recombinant Mouse CCL3/MIP-1α Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse CCL3/MIP-1α Protein (Trx Tag)
PDEM100167-03 500 µg

Recombinant Mouse CCL3/MIP-1α Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse CCL3/MIP-1α Protein (Trx Tag)
PDEM100167-04 1 mg

Recombinant Mouse CCL3/MIP-1α Protein (Trx Tag)

Sign In for Pricing
View Details
USP38 Human Gene Knockout Kit (CRISPR)
KN208974 1 Kit

USP38 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD46 (197-2B1), CF647 conjugate, 0.1mg/mL
BNC470931-100 1x 100 µL

CD46 (197-2B1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details