Fem1c Peptide - C-terminal region
Fem1c Peptide - C-terminal region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fem1c Rabbit Polyclonal Antibody (orb326193) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
D3ZZR4
Preservative
Lyophilized powder
AA Sequence
LHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGNIPEK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470204-100 1x 100 µL
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042897-500 1x 500 µL
Major Vault Protein (MVP) (VP2897R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details