Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnpep Peptide - C-terminal region

Rnpep Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rnpep Rabbit Polyclonal Antibody (orb326196) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

E9PYF1

Preservative

Lyophilized powder

AA Sequence

TCLEAATGRALLRQHMNVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Bromo-3-phenylpropane
TRC-B687060-25G 25 g

1-Bromo-3-phenylpropane

Sign In for Pricing
View Details
Human E1A Binding Protein P300 (EP300) ELISA Kit
RD-EP300-Hu-01 96 Tests

Human E1A Binding Protein P300 (EP300) ELISA Kit

Sign In for Pricing
View Details
Human E1A Binding Protein P300 (EP300) ELISA Kit
RD-EP300-Hu-02 48 Tests

Human E1A Binding Protein P300 (EP300) ELISA Kit

Sign In for Pricing
View Details
Human PBX4 activation kit by CRISPRa
GA112952 1 Kit

Human PBX4 activation kit by CRISPRa

Sign In for Pricing
View Details
CD161 (KLRB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D8]
TA809736BM 100 µL

CD161 (KLRB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D8]

Sign In for Pricing
View Details
Periostin (POSTN) (C-term) Rabbit Polyclonal Antibody
AP53392PU-N 400 µL

Periostin (POSTN) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details