Rnpep Peptide - C-terminal region
Rnpep Peptide - C-terminal region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rnpep Rabbit Polyclonal Antibody (orb326196) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
E9PYF1
Preservative
Lyophilized powder
AA Sequence
TCLEAATGRALLRQHMNVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
R-9005-1 1 mg
TRITC Conjugated Morniga G Lectin (black mulberry) -MNA-G-
Sign In for Pricing
View Details 
