Ppp3cb Peptide - middle region
Ppp3cb Peptide - middle region
Product Specifications
Product Name Alternative
Calna2
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ppp3cb Rabbit Polyclonal Antibody (orb583595) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
P20651
Preservative
Lyophilized powder
AA Sequence
MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx142220-01 50 µL
Secreted Frizzled Related Protein 4 (SFRP4) Antibody
Sign In for Pricing
View Details 
abx142220-02 100 µL
Secreted Frizzled Related Protein 4 (SFRP4) Antibody
Sign In for Pricing
View Details 
abx142220-03 200 µL
Secreted Frizzled Related Protein 4 (SFRP4) Antibody
Sign In for Pricing
View Details 