Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abhd4 Peptide - N-terminal region

Abhd4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Abh4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abhd4 Rabbit Polyclonal Antibody (orb330930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

D3ZAW4

Preservative

Lyophilized powder

AA Sequence

DRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPTFPRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC5 Polyclonal Antibody
E-AB-64590-01 60 µL

XRCC5 Polyclonal Antibody

Sign In for Pricing
View Details
XRCC5 Polyclonal Antibody
E-AB-64590-02 120 µL

XRCC5 Polyclonal Antibody

Sign In for Pricing
View Details
XRCC5 Polyclonal Antibody
E-AB-64590-03 200 µL

XRCC5 Polyclonal Antibody

Sign In for Pricing
View Details
GSK2983559 free acid 10mg
A22272-10 10 mg

GSK2983559 free acid 10mg

Sign In for Pricing
View Details
NOVA1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-11324R-BF647 100 µL

NOVA1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Guinea Pig Lipoic Acid ELISA kit
GTR10379071 96 Well

Guinea Pig Lipoic Acid ELISA kit

Sign In for Pricing
View Details