Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abhd4 Peptide - N-terminal region

Abhd4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Abh4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abhd4 Rabbit Polyclonal Antibody (orb330930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

D3ZAW4

Preservative

Lyophilized powder

AA Sequence

DRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPTFPRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IVD Antibody
CSB-PA011921GA01HU 100 µL

IVD Antibody

Sign In for Pricing
View Details
Olfr784 3'UTR GFP Stable Cell Line
TU165507 1.0 mL

Olfr784 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ITGAX/CD11c, NT (ITGAX, CD11C, Integrin alpha-X, CD11 antigen-like family member C, Leu M5, Leukocyte adhesion glycoprotein p150,95 alpha chain, Leukocyte adhesion receptor p150,95, CD_antigen=CD11c) (MaxLight 490) discontinued
031061-ML490 100 µL

ITGAX/CD11c, NT (ITGAX, CD11C, Integrin alpha-X, CD11 antigen-like family member C, Leu M5, Leukocyte adhesion glycoprotein p150,95 alpha chain, Leukocyte adhesion receptor p150,95, CD_antigen=CD11c) (MaxLight 490) discontinued

Sign In for Pricing
View Details
A230050P20Rik (NM_175687) Mouse Tagged Lenti ORF Clone
MR203969L4 10 µg

A230050P20Rik (NM_175687) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CHRNB1 (NM_000747) Human Tagged ORF Clone Lentiviral Particle
RC204040L3V 200 µL

CHRNB1 (NM_000747) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MCEE Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11G7]
TA808608AM 100 µL

MCEE Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11G7]

Sign In for Pricing
View Details