Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fn3k Peptide - N-terminal region

Fn3k Peptide - N-terminal region

Product Specifications

Product Name Alternative

Fnsk

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fn3k Rabbit Polyclonal Antibody (orb583639) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

LQAQLDLIEKDYADRETQELWSRLQVKIPELFSGIEIVPALLHGDLWSGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A5]
TA506164BM 100 µL

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A5]

Sign In for Pricing
View Details
Recombinant Human UBE2I/UBC9 Protein
PKSH030701 100 µg

Recombinant Human UBE2I/UBC9 Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS625910 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Phospho-PARP Antibody (pS177)
F48726-0.4ML 0.4 mL

Phospho-PARP Antibody (pS177)

Sign In for Pricing
View Details
Mouse Defa29 activation kit by CRISPRa
GA201053 1 Kit

Mouse Defa29 activation kit by CRISPRa

Sign In for Pricing
View Details
Monopropyl Phthalate-d4
TRC-M567102-5MG 5 mg

Monopropyl Phthalate-d4

Sign In for Pricing
View Details