Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fn3k Peptide - N-terminal region

Fn3k Peptide - N-terminal region

Product Specifications

Product Name Alternative

Fnsk

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fn3k Rabbit Polyclonal Antibody (orb583639) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

LQAQLDLIEKDYADRETQELWSRLQVKIPELFSGIEIVPALLHGDLWSGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8a Mouse Gene Knockout Kit (CRISPR)
KN502394 1 Kit

C8a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD27 Mouse Monoclonal Antibody [Clone ID: OTI10B5]
CF812362 100 µg

CD27 Mouse Monoclonal Antibody [Clone ID: OTI10B5]

Sign In for Pricing
View Details
Langerin / CD207 (Marker of Langerhans Cells) (LGRN/3136R), CF647 conjugate, 0.1mg/mL
BNC473136-500 1x 500 µL

Langerin / CD207 (Marker of Langerhans Cells) (LGRN/3136R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-Tau (S199) Recombinant Rabbit Monoclonal Antibody [JE66-80]
HA721667 100 µL

Phospho-Tau (S199) Recombinant Rabbit Monoclonal Antibody [JE66-80]

Sign In for Pricing
View Details
ATP5PD Polyclonal Antibody
E-AB-52881-01 20 µL

ATP5PD Polyclonal Antibody

Sign In for Pricing
View Details
ATP5PD Polyclonal Antibody
E-AB-52881-02 60 µL

ATP5PD Polyclonal Antibody

Sign In for Pricing
View Details