Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab17 Peptide - N-terminal region

Rab17 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW413472

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab17 Rabbit Polyclonal Antibody (orb330933) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

P35292

Preservative

Lyophilized powder

AA Sequence

GSSSLKLEIWDTAGQEKYQSVCHLYFRGANAALLVYDITRKDSFHKAQQW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trifluoroacetic Anhydride
TRC-T786420-25G 25 g

Trifluoroacetic Anhydride

Sign In for Pricing
View Details
Phosphoric Acid Dibenzyl Ester-d10
TRC-P359407-2.5MG 2.5 mg

Phosphoric Acid Dibenzyl Ester-d10

Sign In for Pricing
View Details
Raet1c Mouse Gene Knockout Kit (CRISPR)
KN514430 1 Kit

Raet1c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
D-Biotin Dimer Acid
TRC-B390650-25MG 25 mg

D-Biotin Dimer Acid

Sign In for Pricing
View Details
Diatomaceous earth, Flux-calcined
TRC-D416821-5KG 5 kg

Diatomaceous earth, Flux-calcined

Sign In for Pricing
View Details
HEXA Rabbit Polyclonal Antibody
AP18045PU-N 400 µL

HEXA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details