Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab17 Peptide - N-terminal region

Rab17 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW413472

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab17 Rabbit Polyclonal Antibody (orb330933) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

P35292

Preservative

Lyophilized powder

AA Sequence

GSSSLKLEIWDTAGQEKYQSVCHLYFRGANAALLVYDITRKDSFHKAQQW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL24 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D1]
TA809389AM 100 µL

IL24 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D1]

Sign In for Pricing
View Details
Desmin Antibody
KC-18508-01 50 μL

Desmin Antibody

Sign In for Pricing
View Details
Desmin Antibody
KC-18508-02 100 µL

Desmin Antibody

Sign In for Pricing
View Details
Desmin Antibody
KC-18508-03 1 mL

Desmin Antibody

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3), CF405S conjugate, 0.1mg/mL
BNC040049-500 1x 500 µL

CD31 / PECAM-1 (C31.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EDG3 (S1PR3) Rabbit Polyclonal Antibody
AP01423PU-N 100 µg

EDG3 (S1PR3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details