Tekt3 Peptide - N-terminal region
Tekt3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
4933407G07Rik
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tekt3 Rabbit Polyclonal Antibody (orb583663) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
Q6X6Z7
Preservative
Lyophilized powder
AA Sequence
NSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E15553m 96 Tests
ELISA Kit For Cysteine-rich and transmembrane domain-containing protein 1
Sign In for Pricing
View Details