Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tekt3 Peptide - N-terminal region

Tekt3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4933407G07Rik

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tekt3 Rabbit Polyclonal Antibody (orb583663) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q6X6Z7

Preservative

Lyophilized powder

AA Sequence

NSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dronedarone HCl
S2114-25mg 25 mg

Dronedarone HCl

Sign In for Pricing
View Details
TARBP1 3'UTR GFP Stable Cell Line
TU075128 1.0 mL

TARBP1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Peptidyl-Prolyl Cis-Trans Isomerase FKBP5 (FKBP51) Antibody (ATTO594)
abx440870 100 µg

Peptidyl-Prolyl Cis-Trans Isomerase FKBP5 (FKBP51) Antibody (ATTO594)

Sign In for Pricing
View Details
Anti-COMP Antibody Picoband® Fluoro594 Conjugated
A02443-1-Fluoro594 100 µg/Vial

Anti-COMP Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
PDE2A1 Peptide
MBS544171-01 0.25 mg

PDE2A1 Peptide

Sign In for Pricing
View Details
PDE2A1 Peptide
MBS544171-02 5x 0.25 mg

PDE2A1 Peptide

Sign In for Pricing
View Details