Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADRM1 Peptide - N-terminal region

ADRM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARM1, GP110, Rpn13

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADRM1 Rabbit Polyclonal Antibody (orb331038) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q16186

Preservative

Lyophilized powder

AA Sequence

PSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35B2 Antibody
abx148006-01 50 µL

SLC35B2 Antibody

Sign In for Pricing
View Details
SLC35B2 Antibody
abx148006-02 100 µL

SLC35B2 Antibody

Sign In for Pricing
View Details
RASA1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H1]
TA505900AM 100 µL

RASA1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H1]

Sign In for Pricing
View Details
CFHR3 Peptide
DF12363-BP 1 mg

CFHR3 Peptide

Sign In for Pricing
View Details
Coronin 3 (CORO1C) Human shRNA Plasmid Kit (Locus ID 23603)
TR313771 1 Kit

Coronin 3 (CORO1C) Human shRNA Plasmid Kit (Locus ID 23603)

Sign In for Pricing
View Details
M13 Bacteriophage
MBS606915-01 0.25 mg

M13 Bacteriophage

Sign In for Pricing
View Details