Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GGA2 Peptide - N-terminal region

GGA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

VEAR

UniProt

Q9UJY4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GGA2 Rabbit Polyclonal Antibody (orb585858) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055859

Preservative

Lyophilized powder

AA Sequence

MLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Lysozyme Antibody (BGN/0696/5B1)
NB100-63062-0.025mg 0.025 mg

Mouse Monoclonal Lysozyme Antibody (BGN/0696/5B1)

Sign In for Pricing
View Details
Recombinant Kinesin Light Chain 1 (KLC1)
SIPC808Hu01-01 10 µg

Recombinant Kinesin Light Chain 1 (KLC1)

Sign In for Pricing
View Details
Recombinant Kinesin Light Chain 1 (KLC1)
SIPC808Hu01-02 50 µg

Recombinant Kinesin Light Chain 1 (KLC1)

Sign In for Pricing
View Details
Recombinant Kinesin Light Chain 1 (KLC1)
SIPC808Hu01-03 200 µg

Recombinant Kinesin Light Chain 1 (KLC1)

Sign In for Pricing
View Details
Recombinant Kinesin Light Chain 1 (KLC1)
SIPC808Hu01-04 1 mg

Recombinant Kinesin Light Chain 1 (KLC1)

Sign In for Pricing
View Details
Recombinant Kinesin Light Chain 1 (KLC1)
SIPC808Hu01-05 5 mg

Recombinant Kinesin Light Chain 1 (KLC1)

Sign In for Pricing
View Details