Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMG2 Peptide - C-terminal region

PSMG2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLAST3, HCCA3, HsT1707, MDS003, PAC2, TNFSF5IP1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMG2 Rabbit Polyclonal Antibody (orb586887) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q969U7

Preservative

Lyophilized powder

AA Sequence

PSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SCAMP4 activation kit by CRISPRa
GA114391 1 Kit

Human SCAMP4 activation kit by CRISPRa

Sign In for Pricing
View Details
trans-p-Coumaric-d6 Acid
TRC-C755392-5MG 5 mg

trans-p-Coumaric-d6 Acid

Sign In for Pricing
View Details
HSCB Human Gene Knockout Kit (CRISPR)
KN400843 1 Kit

HSCB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ccdc159 Mouse Gene Knockout Kit (CRISPR)
KN502676 1 Kit

Ccdc159 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GFAP Rabbit Polyclonal Antibody
R1308-10 100 µL

GFAP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
p27 KIP 1 (CDKN1B) Rabbit Polyclonal Antibody
AP06264PU-N 100 µg

p27 KIP 1 (CDKN1B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details