Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMG2 Peptide - C-terminal region

PSMG2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLAST3, HCCA3, HsT1707, MDS003, PAC2, TNFSF5IP1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMG2 Rabbit Polyclonal Antibody (orb586887) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q969U7

Preservative

Lyophilized powder

AA Sequence

PSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DL-Glutamic-d3 Acid
TRC-D525948-2.5MG 2.5 mg

DL-Glutamic-d3 Acid

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF594 conjugate, 0.1mg/mL
BNC942259-500 1x 500 µL

Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Keto-Isoxsuprine Hydrochloride Salt
TRC-K606400-10MG 10 mg

Keto-Isoxsuprine Hydrochloride Salt

Sign In for Pricing
View Details
Human Herpes Virus 8 (HHV8) (LN53), CF594 conjugate, 0.1mg/mL
BNC941746-500 1x 500 µL

Human Herpes Virus 8 (HHV8) (LN53), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SFMBT2 activation kit by CRISPRa
GA111706 1 Kit

Human SFMBT2 activation kit by CRISPRa

Sign In for Pricing
View Details
UBN2 (NM_173569) Human Over-expression Lysate
LC432442 20 µg

UBN2 (NM_173569) Human Over-expression Lysate

Sign In for Pricing
View Details