Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSRC1 Peptide - N-terminal region

RSRC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SFRS21, SRrp53

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RSRC1 Rabbit Polyclonal Antibody (orb586891) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q96IZ7

Preservative

Lyophilized powder

AA Sequence

SRTYSRKKGGRKSRSKSRSWSRDLQPRSHSYDRRRRHRSSSSSSYGSRRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GCLC Rabbit Monoclonal Antibody
MA2783-.05 50 µL

Anti-GCLC Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DnaJC6 CRISPR Activation Plasmid (m2)
sc-428412-ACT-2 20 µg

DnaJC6 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
CYP72A11 Antibody
orb785952 2 mg

CYP72A11 Antibody

Sign In for Pricing
View Details
PFKP (PhosphofructoKinase (Platelet) Human ELISA Kit
F7979 96 Tests

PFKP (PhosphofructoKinase (Platelet) Human ELISA Kit

Sign In for Pricing
View Details
AtpF Antibody
orb838512 2 mg

AtpF Antibody

Sign In for Pricing
View Details
IGHG1 Protein Vector (Human) (pPM-C-HA)
PV020975 500 ng

IGHG1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details