Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSRC1 Peptide - N-terminal region

RSRC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SFRS21, SRrp53

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RSRC1 Rabbit Polyclonal Antibody (orb586891) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q96IZ7

Preservative

Lyophilized powder

AA Sequence

SRTYSRKKGGRKSRSKSRSWSRDLQPRSHSYDRRRRHRSSSSSSYGSRRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-a-Benzoyl-DL-Arginine-4-Nitroanilide Hydrochloride (BANI, L-BAPNA) extrapure, 98%
96249-01 100 mg

N-a-Benzoyl-DL-Arginine-4-Nitroanilide Hydrochloride (BANI, L-BAPNA) extrapure, 98%

Sign In for Pricing
View Details
N-a-Benzoyl-DL-Arginine-4-Nitroanilide Hydrochloride (BANI, L-BAPNA) extrapure, 98%
96249-02 250 mg

N-a-Benzoyl-DL-Arginine-4-Nitroanilide Hydrochloride (BANI, L-BAPNA) extrapure, 98%

Sign In for Pricing
View Details
N-a-Benzoyl-DL-Arginine-4-Nitroanilide Hydrochloride (BANI, L-BAPNA) extrapure, 98%
96249-03 1 g

N-a-Benzoyl-DL-Arginine-4-Nitroanilide Hydrochloride (BANI, L-BAPNA) extrapure, 98%

Sign In for Pricing
View Details
EPRS1 Rabbit Polyclonal Antibody
E10G06574 100 µL

EPRS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human RND1 Protein Lysate
MBS8418658-01 0.02 mg

Human RND1 Protein Lysate

Sign In for Pricing
View Details
Human RND1 Protein Lysate
MBS8418658-02 5x 0.02 mg

Human RND1 Protein Lysate

Sign In for Pricing
View Details