Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP300 Peptide - C-terminal region

CFAP300 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CILD38, C11orf70

UniProt

Q9BRQ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFAP300 Rabbit Polyclonal Antibody (orb326726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_116319

Preservative

Lyophilized powder

AA Sequence

ELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTM1 (NM_000561) Human Over-expression Lysate
LY424640 100 µg

GSTM1 (NM_000561) Human Over-expression Lysate

Sign In for Pricing
View Details
L-Alanine tert-Butyl Ester Hydrochloride
TRC-A481015-25G 25 g

L-Alanine tert-Butyl Ester Hydrochloride

Sign In for Pricing
View Details
HSP27 (Ab-78) Antibody
8B7111-AAT 50 µg

HSP27 (Ab-78) Antibody

Sign In for Pricing
View Details
TRAP alpha Rabbit Polyclonal Antibody
HA500105 100 µL

TRAP alpha Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MPG (NM_001015054) Human Over-expression Lysate
LY423120 100 µg

MPG (NM_001015054) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783Q-01 25 µg

Elab Fluor® Violet 450 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details