Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP300 Peptide - C-terminal region

CFAP300 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CILD38, C11orf70

UniProt

Q9BRQ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFAP300 Rabbit Polyclonal Antibody (orb326726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_116319

Preservative

Lyophilized powder

AA Sequence

ELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAGL1 (NM_001080955) Human Over-expression Lysate
LC421139 20 µg

PLAGL1 (NM_001080955) Human Over-expression Lysate

Sign In for Pricing
View Details
alpha smooth muscle Actin (ACTA2) (NM_001613) Human Over-expression Lysate
LC400608 20 µg

alpha smooth muscle Actin (ACTA2) (NM_001613) Human Over-expression Lysate

Sign In for Pricing
View Details
DRP2 (NM_001939) Human Over-expression Lysate
LC419641 20 µg

DRP2 (NM_001939) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS711395 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
IFluor® 350-streptavidin conjugate
16950-AAT 200 µg

IFluor® 350-streptavidin conjugate

Sign In for Pricing
View Details
(Phenylthio)acetaldehyde Diethyl Acetal
TRC-P337075-10MG 10 mg

(Phenylthio)acetaldehyde Diethyl Acetal

Sign In for Pricing
View Details