Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRNIP Peptide - N-terminal region

MRNIP Peptide - N-terminal region

Product Specifications

Product Name Alternative

C5orf45

UniProt

Q6NTE8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRNIP Rabbit Polyclonal Antibody (orb587068) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057259

Preservative

Lyophilized powder

AA Sequence

QGQVSELPLRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHBG Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-2410R-BF647-TR 20 µL

SHBG Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Anti-MOCS2 Antibody Picoband®, Carrier-free
A07401-carrier-free 100 µg/Vial

Anti-MOCS2 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
EXT3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0704807 1.0 µg DNA

EXT3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Trove2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6629508 1.0 µg DNA

Trove2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Dexamethasone 17-propionate
271779-01 1 mg

Dexamethasone 17-propionate

Sign In for Pricing
View Details
Dexamethasone 17-propionate
271779-02 2 mg

Dexamethasone 17-propionate

Sign In for Pricing
View Details