Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRNIP Peptide - N-terminal region

MRNIP Peptide - N-terminal region

Product Specifications

Product Name Alternative

C5orf45

UniProt

Q6NTE8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRNIP Rabbit Polyclonal Antibody (orb587068) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057259

Preservative

Lyophilized powder

AA Sequence

QGQVSELPLRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIM1 (Pim-1 Oncogene, OTTHUMP00000018046, Oncogene PIM1, Non-specific serine/threonine Protein Kinase, Pim-1 Kinase 44kD isoform, Pim-1 Oncogene (proviral integration site 1), PIM) (APC)
207843-APC 100 µL

PIM1 (Pim-1 Oncogene, OTTHUMP00000018046, Oncogene PIM1, Non-specific serine/threonine Protein Kinase, Pim-1 Kinase 44kD isoform, Pim-1 Oncogene (proviral integration site 1), PIM) (APC)

Sign In for Pricing
View Details
Human Renal Epithelial Cells [HKb20]
AFG-ELL-0496 > 1x 10^6 Cells / Vial

Human Renal Epithelial Cells [HKb20]

Sign In for Pricing
View Details
Recombinant Lemniscomys barbarus Cytochrome c oxidase subunit 2 (MT-CO2)
orb2928705-01 20 µg

Recombinant Lemniscomys barbarus Cytochrome c oxidase subunit 2 (MT-CO2)

Sign In for Pricing
View Details
Recombinant Lemniscomys barbarus Cytochrome c oxidase subunit 2 (MT-CO2)
orb2928705-02 100 µg

Recombinant Lemniscomys barbarus Cytochrome c oxidase subunit 2 (MT-CO2)

Sign In for Pricing
View Details
Anti-Phenobarbital Antibody
16405-1000 1mg

Anti-Phenobarbital Antibody

Sign In for Pricing
View Details
CSTF3 293 Cell Lysate
409362 0.1 mg

CSTF3 293 Cell Lysate

Sign In for Pricing
View Details