Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5DC3 Peptide - N-terminal region

NT5DC3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TU12B1-TY, TU12B1TY

UniProt

Q86UY8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NT5DC3 Rabbit Polyclonal Antibody (orb587071) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001026871

Preservative

Lyophilized powder

AA Sequence

AARGRPCAGPARPLCTAPGTAPDMKRYLWERYREAKRSTEELVPSIMSNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human PDGF-AB (Platelet Derived Growth Factor AB) ELISA Kit
MBS2571782-01 24 Tests (Limit 1)

Uncoated Human PDGF-AB (Platelet Derived Growth Factor AB) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human PDGF-AB (Platelet Derived Growth Factor AB) ELISA Kit
MBS2571782-02 5x 96 Tests

Uncoated Human PDGF-AB (Platelet Derived Growth Factor AB) ELISA Kit

Sign In for Pricing
View Details
BMAL1 (9K1) Rabbit Monoclonal Antibody
E28M1556 100 µL

BMAL1 (9K1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Canine Mediator of RNA polymerase II transcription subunit 12 like protein (MED12L) ELISA kit
GTR10407195 96 Well

Canine Mediator of RNA polymerase II transcription subunit 12 like protein (MED12L) ELISA kit

Sign In for Pricing
View Details
Rab5C monoclonal antibody
orb1724792-01 50 µL

Rab5C monoclonal antibody

Sign In for Pricing
View Details
Rab5C monoclonal antibody
orb1724792-02 100 µL

Rab5C monoclonal antibody

Sign In for Pricing
View Details