Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT17 Peptide - middle region

SYT17 Peptide - middle region

Product Specifications

UniProt

Q9BSW7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYT17 Rabbit Polyclonal Antibody (orb587073) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057608

Preservative

Lyophilized powder

AA Sequence

CLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNGR2 Antibody - middle region : Biotin (ARP46611_P050-Biotin)
ARP46611_P050-Biotin 100 µL

IFNGR2 Antibody - middle region : Biotin (ARP46611_P050-Biotin)

Sign In for Pricing
View Details
Anti-Human CSF3/G-CSF Antibody (SAA0419), FITC
MBS1583053-01 50 Tests

Anti-Human CSF3/G-CSF Antibody (SAA0419), FITC

Sign In for Pricing
View Details
Anti-Human CSF3/G-CSF Antibody (SAA0419), FITC
MBS1583053-02 100 Tests

Anti-Human CSF3/G-CSF Antibody (SAA0419), FITC

Sign In for Pricing
View Details
Anti-Human CSF3/G-CSF Antibody (SAA0419), FITC
MBS1583053-03 5x 100 Tests

Anti-Human CSF3/G-CSF Antibody (SAA0419), FITC

Sign In for Pricing
View Details
FITC anti-Chicken CD3
FC1229 100 Tests

FITC anti-Chicken CD3

Sign In for Pricing
View Details
ABCG4 Protein Vector (Human) (pPM-C-His)
PV000152 500 ng

ABCG4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details