SYT17 Peptide - middle region
SYT17 Peptide - middle region
Product Specifications
UniProt
Q9BSW7
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SYT17 Rabbit Polyclonal Antibody (orb587073) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057608
Preservative
Lyophilized powder
AA Sequence
CLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0112108 1.0 µg DNA
AREGB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
50805064 1.0 µg DNA
ZDHHC5 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
K3637507 1.0 µg DNA
Fam109b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details