Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD16 Peptide - N-terminal region

ANKRD16 Peptide - N-terminal region

Product Specifications

UniProt

Q6P6B7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD16 Rabbit Polyclonal Antibody (orb587075) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061919

Preservative

Lyophilized powder

AA Sequence

CAARHGHRDVLAYLAEAWGMDIEATNRDYKRPLHEAASMGHRDCVRYLLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Boc Alogliptin
TRC-B477780-1G 1 g

N-Boc Alogliptin

Sign In for Pricing
View Details
Rbm17 Mouse Gene Knockout Kit (CRISPR)
KN514553 1 Kit

Rbm17 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
COMMD6 (NM_203495) Human Over-expression Lysate
LC404247 20 µg

COMMD6 (NM_203495) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: right upper lobe
CS640606 5x 5 µm

Frozen Tissue Sections, Lung: right upper lobe

Sign In for Pricing
View Details
Anti-H+ATPase | Plasma membrane H+ATPase (rabbit antibody), HRP-conjugated (40 µg)
AS07 260-HRP 40 µg

Anti-H+ATPase | Plasma membrane H+ATPase (rabbit antibody), HRP-conjugated (40 µg)

Sign In for Pricing
View Details
1-[2-(2,4-Difluorophenyl)-2,3-epoxypropyl]-1H-1,2,4-triazole
TRC-D446045-1G 1 g

1-[2-(2,4-Difluorophenyl)-2,3-epoxypropyl]-1H-1,2,4-triazole

Sign In for Pricing
View Details