Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD16 Peptide - N-terminal region

ANKRD16 Peptide - N-terminal region

Product Specifications

UniProt

Q6P6B7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD16 Rabbit Polyclonal Antibody (orb587075) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061919

Preservative

Lyophilized powder

AA Sequence

CAARHGHRDVLAYLAEAWGMDIEATNRDYKRPLHEAASMGHRDCVRYLLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2C1 (NM_001032287) Human Over-expression Lysate
LY422297 100 µg

NR2C1 (NM_001032287) Human Over-expression Lysate

Sign In for Pricing
View Details
Ccdc28b (NM_025455) Mouse Tagged ORF Clone
MG202023 10 µg

Ccdc28b (NM_025455) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: bilateral
CS630812 5x 5 µm

Frozen Tissue Sections, Ovary: bilateral

Sign In for Pricing
View Details
NDUFB11 Mouse Monoclonal Antibody [Clone ID: OTI2E10]
CF807710 100 µg

NDUFB11 Mouse Monoclonal Antibody [Clone ID: OTI2E10]

Sign In for Pricing
View Details
Human IL-16, C-His Tag
HA210917-01 20 µg

Human IL-16, C-His Tag

Sign In for Pricing
View Details
Human IL-16, C-His Tag
HA210917-02 50 µg

Human IL-16, C-His Tag

Sign In for Pricing
View Details