Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5orf22 Peptide - middle region

C5orf22 Peptide - middle region

Product Specifications

UniProt

Q49AR2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C5orf22 Rabbit Polyclonal Antibody (orb587085) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060826

Preservative

Lyophilized powder

AA Sequence

QLDVIMVKPYKLCNNQEENDAVSSAKKPKLALEDSENTASTNCDSSSEGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP7A1 (NM_000780) Human Recombinant Protein
TP311019M 100 µg

CYP7A1 (NM_000780) Human Recombinant Protein

Sign In for Pricing
View Details
Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI4F4]
CF812300 100 µg

Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI4F4]

Sign In for Pricing
View Details
Cathepsin L (CTSL) Mouse Monoclonal Antibody [Clone ID: OTI2C10]
CF812843 100 µg

Cathepsin L (CTSL) Mouse Monoclonal Antibody [Clone ID: OTI2C10]

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CC49), 0.2mg/mL
BNUB0732-100 1x 100 µL

TAG-72 / CA72.4 (CC49), 0.2mg/mL

Sign In for Pricing
View Details
TSGA10IP (C-term) Rabbit Polyclonal Antibody
AP54371PU-N 400 µL

TSGA10IP (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS502551 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details