Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5orf22 Peptide - middle region

C5orf22 Peptide - middle region

Product Specifications

UniProt

Q49AR2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C5orf22 Rabbit Polyclonal Antibody (orb587085) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060826

Preservative

Lyophilized powder

AA Sequence

QLDVIMVKPYKLCNNQEENDAVSSAKKPKLALEDSENTASTNCDSSSEGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 7 (KRT7/1198), 0.2mg/mL
BNUB1198-100 1x 100 µL

Cytokeratin 7 (KRT7/1198), 0.2mg/mL

Sign In for Pricing
View Details
IL-21R Rabbit Polyclonal Antibody
HA500290 100 µL

IL-21R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FBXO46 (NM_001080469) Human Over-expression Lysate
LC420726 20 µg

FBXO46 (NM_001080469) Human Over-expression Lysate

Sign In for Pricing
View Details
PRODH2 (Center) Rabbit Polyclonal Antibody
AP53449PU-N 400 µL

PRODH2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SLC16A13 activation kit by CRISPRa
GA116384 1 Kit

Human SLC16A13 activation kit by CRISPRa

Sign In for Pricing
View Details
WNT9A (Center) Rabbit Polyclonal Antibody
AP54570PU-N 400 µL

WNT9A (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details