Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP1AR Peptide - C-terminal region

AP1AR Peptide - C-terminal region

Product Specifications

Product Name Alternative

2C18, C4orf16, GBAR, gamma-BAR

UniProt

Q63HQ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AP1AR Rabbit Polyclonal Antibody (orb326787) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061039

Preservative

Lyophilized powder

AA Sequence

DSTSLDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYSNKKTGSNPTSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N6- (6-Aminohexyl) -ADP-ATTO-532
NU-247-532 40 µL

N6- (6-Aminohexyl) -ADP-ATTO-532

Sign In for Pricing
View Details
Mouse NPFF (Neuropeptide FF) ELISA Kit
EM23134 96 Tests

Mouse NPFF (Neuropeptide FF) ELISA Kit

Sign In for Pricing
View Details
TOP2A Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8124280-01 0.1 mL

TOP2A Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details
TOP2A Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8124280-02 5x 0.1 mL

TOP2A Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details
MED19 Antibody (C-term) Blocking Peptide
MBS9223637-01 0.5 mg

MED19 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
MED19 Antibody (C-term) Blocking Peptide
MBS9223637-02 5x 0.5 mg

MED19 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details