Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf56 Peptide - C-terminal region

C2orf56 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MidA, C2orf56

UniProt

Q7L592

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C2orf56 Rabbit Polyclonal Antibody (orb587090) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653337

Preservative

Lyophilized powder

AA Sequence

QQLLQGYDMLMNPKKMGERFNFFALLPHQRLQGGRYQRNARQSKPFASVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Leishmania Pifanoi CYS1 Protein (aa 126-354)
VAng-Wyb7559-100gBaculovirus 100 µg (Baculovirus)

Recombinant Leishmania Pifanoi CYS1 Protein (aa 126-354)

Sign In for Pricing
View Details
Olfr746 sgRNA CRISPR Lentivector set (Mouse)
K4253701 3x 1.0 µg

Olfr746 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
L-Lysine hydrochloride
90029187 5 g

L-Lysine hydrochloride

Sign In for Pricing
View Details
Mouse Micall1 activation kit by CRISPRa
GA205068 1 Kit

Mouse Micall1 activation kit by CRISPRa

Sign In for Pricing
View Details
AXIN2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV673525 1.0 µg DNA

AXIN2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
WTIP Rabbit Polyclonal Antibody (C-term)
E28PB0966 100 µL

WTIP Rabbit Polyclonal Antibody (C-term)

Sign In for Pricing
View Details