Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf56 Peptide - C-terminal region

C2orf56 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MidA, C2orf56

UniProt

Q7L592

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C2orf56 Rabbit Polyclonal Antibody (orb587090) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653337

Preservative

Lyophilized powder

AA Sequence

QQLLQGYDMLMNPKKMGERFNFFALLPHQRLQGGRYQRNARQSKPFASVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Huntingtin Recombinant Antibody, Biotin Conjugated
bsm-54305R-Biotin-TR 20 µL

Huntingtin Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Myosin VA (MYO5A) Antibody (Biotin)
abx338247-01 20 µg

Myosin VA (MYO5A) Antibody (Biotin)

Sign In for Pricing
View Details
Myosin VA (MYO5A) Antibody (Biotin)
abx338247-02 50 µg

Myosin VA (MYO5A) Antibody (Biotin)

Sign In for Pricing
View Details
Myosin VA (MYO5A) Antibody (Biotin)
abx338247-03 100 µg

Myosin VA (MYO5A) Antibody (Biotin)

Sign In for Pricing
View Details
Myosin VA (MYO5A) Antibody (Biotin)
abx338247-04 200 µg

Myosin VA (MYO5A) Antibody (Biotin)

Sign In for Pricing
View Details
Myosin VA (MYO5A) Antibody (Biotin)
abx338247-05 1 mg

Myosin VA (MYO5A) Antibody (Biotin)

Sign In for Pricing
View Details