Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COA1 Peptide - C-terminal region

COA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C7orf44

UniProt

Q9GZY4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COA1 Rabbit Polyclonal Antibody (orb326793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060694

Preservative

Lyophilized powder

AA Sequence

KSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNP-32 (human)
H-7774.1000 1.0mg

BNP-32 (human)

Sign In for Pricing
View Details
SLC16A8 (NM_013356) Human Tagged ORF Clone Lentiviral Particle
RC216789L4V 200 µL

SLC16A8 (NM_013356) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human IgG (H&L) Antibody Fluorescein Conjugated
orb347324 2 mg

Human IgG (H&L) Antibody Fluorescein Conjugated

Sign In for Pricing
View Details
HNF1B Rabbit pAb
E45R25117N-50 50 µL

HNF1B Rabbit pAb

Sign In for Pricing
View Details
Osbpl2 AAV siRNA Pooled Vector
35754164 1.0 µg

Osbpl2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
PCDH-CMV-FOXM1EF1A-EGFP-T2A-PURO
BZ0808-2 1 Vial

PCDH-CMV-FOXM1EF1A-EGFP-T2A-PURO

Sign In for Pricing
View Details