Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COA1 Peptide - C-terminal region

COA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C7orf44

UniProt

Q9GZY4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COA1 Rabbit Polyclonal Antibody (orb326793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060694

Preservative

Lyophilized powder

AA Sequence

KSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Procalcitonin, PCT ELISA Kit
MBS1602047-01 48 Well

Horse Procalcitonin, PCT ELISA Kit

Sign In for Pricing
View Details
Horse Procalcitonin, PCT ELISA Kit
MBS1602047-02 96 Well

Horse Procalcitonin, PCT ELISA Kit

Sign In for Pricing
View Details
Horse Procalcitonin, PCT ELISA Kit
MBS1602047-03 5x 96 Well

Horse Procalcitonin, PCT ELISA Kit

Sign In for Pricing
View Details
Horse Procalcitonin, PCT ELISA Kit
MBS1602047-04 10x 96 Well

Horse Procalcitonin, PCT ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Arap1 shRNA (UAS) - Lentiviral mouse Arap1 shRNA (UAS, iRFP) (100)
GTR15253575 1 Vial

Lentiviral mouse Arap1 shRNA (UAS) - Lentiviral mouse Arap1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Duck Neurokinin-1 Receptor (NK1R) ELISA Kit
MBS9910642 Inquire

Duck Neurokinin-1 Receptor (NK1R) ELISA Kit

Sign In for Pricing
View Details